PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G01680.3
Common NameAtMYB55, MYB55
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 241aa    MW: 27359 Da    PI: 9.4427
Description myb domain protein 55
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G01680.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
      AT4G01680.3 14 KGLWSPEEDEKLLRYITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.49.3e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
      AT4G01680.3  67 RGAFSQDEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.666965IPR017930Myb domain
SuperFamilySSF466894.12E-3012108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
CDDcd001677.15E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2565116IPR009057Homeodomain-like
SMARTSM007179.1E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.79966116IPR017930Myb domain
PfamPF002491.1E-1367111IPR001005SANT/Myb domain
CDDcd001677.60E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRYIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQDEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRLRG  120
IDPVTHKLLT EIETGTDDKT KPVEKSQQTY LVETDGSSST TTCSTNQNNN TDHLYTGNFG  180
FQRLSLENGS RIAAGSDLGI WIPQTGRNHH HHVDETIPSA VSISKFKRVT TTIQHSLEMG  240
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453398990.0
Genevisible255538_at1e-129
Expression AtlasAT4G01680-
AtGenExpressAT4G01680-
ATTED-IIAT4G01680-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB55).
Function -- GeneRIF ? help Back to Top
  1. MYB55 was higher expressed in basal cells than in trichome and pavement cells.
    [PMID: 20101514]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00427DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G01680.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G01680
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1760000.0AF176000.2 Arabidopsis thaliana putative transcription factor (MYB55) mRNA, complete cds.
GenBankAY0545750.0AY054575.1 Arabidopsis thaliana Unknown protein (At4g01680; T15B16.4) mRNA, complete cds.
GenBankBT0003520.0BT000352.1 Arabidopsis thaliana Unknown protein (At4g01680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118913.10.0putative transcription factor MYB55
SwissprotQ8LPH61e-84MYB86_ARATH; Transcription factor MYB86
TrEMBLB3H6640.0B3H664_ARATH; Myb domain protein 55
STRINGAT4G01680.21e-154(Arabidopsis thaliana)
STRINGfgenesh2_kg.6__3543__AT4G01680.11e-154(Arabidopsis lyrata)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  4. He JX, et al.
    BZR1 is a transcriptional repressor with dual roles in brassinosteroid homeostasis and growth responses.
    Science, 2005. 307(5715): p. 1634-8
    [PMID:15681342]
  5. Nakamura A, et al.
    Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type.
    Plant J., 2006. 45(2): p. 193-205
    [PMID:16367964]
  6. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  7. Zhao J, et al.
    Analysis of gene expression profiles in response to Sclerotinia sclerotiorum in Brassica napus.
    Planta, 2007. 227(1): p. 13-24
    [PMID:17665211]
  8. Schliep M,Ebert B,Simon-Rosin U,Zoeller D,Fisahn J
    Quantitative expression analysis of selected transcription factors in pavement, basal and trichome cells of mature leaves from Arabidopsis thaliana.
    Protoplasma, 2010. 241(1-4): p. 29-36
    [PMID:20101514]
  9. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]